PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10016755m
Common NameEUTSA_v10016755mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family GeBP
Protein Properties Length: 397aa    MW: 45288.5 Da    PI: 4.1425
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10016755mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57396.33.1e-3064158397
           DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                      ++++ws++ e+v+L  ++d++++t++s+ +d+d+fy +vk+ i++++sk+ql++Ki++LKk+f ++++++ +gk  sf++++d++if+ s++iW
  Thhalv10016755m  64 SKMIWSKNEELVILGSIVDYEKETKMSYRSDWDGFYGYVKDFIEANFSKQQLMDKIKNLKKRFLNNQARSIKGKGLSFTNTDDDEIFKTSMIIW 157
                      789******************************************************************************************* PP

           DUF573  97 g 97 
                       
  Thhalv10016755m 158 A 158
                      6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.0E-2365157IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MVSKKRLTCR DDSDDSSSDC LEIRPSGLPL PSSLLTRKHD DDISGTETML RKRKQAKTIA  60
SSSSKMIWSK NEELVILGSI VDYEKETKMS YRSDWDGFYG YVKDFIEANF SKQQLMDKIK  120
NLKKRFLNNQ ARSIKGKGLS FTNTDDDEIF KTSMIIWATN ETERASNENI DQAKDVPCVE  180
HESADENDEN MDQATAKVID LNKDVPSEEN ELVNENMDPA QDVPFAEHAQ ANENMEQENE  240
DVPYAEHEQV DENMDQENED VPYAEHERVD ENVDQENVDV PNAEHEQANE NMDQENDVPD  300
VEHEPVSDIT LENGKGEDEE GEEAGVDEMA TLQDALEAMT WYQSFGQYQQ NRLRQNLKNI  360
GAQRRKELAD EWKALLGEEM RLYARKLTLA ARLASA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410809.10.0hypothetical protein EUTSA_v10016755mg
TrEMBLV4MAU70.0V4MAU7_EUTSA; Uncharacterized protein
STRINGBra017244.1-P1e-113(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM124401528
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36340.19e-82DNA-binding storekeeper protein-related transcriptional regulator